Tankyrase-tankyrase.com

Anti-mTOR Antibody (pSer2448)

Anti-mTOR Antibody (pSer2448)__Rabbit Anti-Human mTOR (pSer2448) Polyclonal CH5424803

Product Name mTOR Antibody (pSer2448)

Description
Rabbit Anti-Human mTOR (pSer2448) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Ser2448 of human mTOR (AA2445-2451)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 288.892 kDa.

Cite This Product Rabbit Anti-Human mTOR (pSer2448) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1034)

Certificate of Analysis A 1:250 dilution of SPC-1034 was sufficient for detection of mTOR (pSer2448) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

Alternative Names FK506 binding protein 12 rapamycin associated protein 1 antibody, FK506 binding protein 12 rapamycin associated protein 2 antibody, FKBP rapamycin associated protein antibody, FKBP12 rapamycin complex associated protein antibody, FRAP antibody, FRAP1 antibody, FRAP2 antibody, Mammalian target of rapamycin antibody, Mechanistic target of rapamycin antibody, mTOR antibody, MTOR_HUMAN antibody, RAFT1 antibody, Rapamycin and FKBP12 target 1 antibody, Rapamycin target protein 1 antibody, Rapamycin target protein antibody, RAPT1 antibody, Serine/threonine-protein kinase mTOR antibody

Cellular Localization Cytoplasm, Endoplasmic reticulum membrane, Golgi Apparatus Membrane, Lysosome

Accession Number NP_004949

Gene ID 2475

Swiss Prot P42345

Scientific Background MTOR is a protein-serine/threonine kinase. It regulates various cellular pathways such as insulin signalling, eIF4e and p70S6 kinase activation for protein synthesis, HIFa, VEGF, cell proliferation, nutrient and hormone signals, ribosome biogenesis, regulation of cell cycle progrssion, angiogensis, cell polarity and cytokeleton reorganization. Dysregulation in signalling that leads to constant activation of mTOR lead to uncontrolled prolifertaion and cell cycle progression and oncogensis. Increased invasiveness has also be shown do be associated with mTOR activity. While it features a wide range of mutations, this might reflect the very large size of the protein rather than its identification as a tumour suppressor protein.

Anti-mTOR Antibody

Anti-mTOR Antibody__Rabbit Anti-Human mTOR Polyclonal Glesatinib (hydrochloride)

Product Name mTOR Antibody

Description
Rabbit Anti-Human mTOR Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide of human mTOR (AA2492-2505)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 288.892 kDa.

Cite This Product Rabbit Anti-Human mTOR Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1176)

Certificate of Analysis A 1:250 dilution of SPC-1176 was sufficient for detection of mTOR in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

Alternative Names FK506 binding protein 12 rapamycin associated protein 1 antibody, FK506 binding protein 12 rapamycin associated protein 2 antibody, FKBP rapamycin associated protein antibody, FKBP12 rapamycin complex associated protein antibody, FRAP antibody, FRAP1 antibody, FRAP2 antibody, Mammalian target of rapamycin antibody, Mechanistic target of rapamycin antibody, mTOR antibody, MTOR_HUMAN antibody, RAFT1 antibody, Rapamycin and FKBP12 target 1 antibody, Rapamycin target protein 1 antibody, Rapamycin target protein antibody, RAPT1 antibody, Serine/threonine-protein kinase mTOR antibody

Cellular Localization Cytoplasm, Endoplasmic reticulum membrane, Golgi Apparatus Membrane, Lysosome

Accession Number NP_004949

Gene ID 2475

Swiss Prot P42345

Scientific Background MTOR is a protein-serine/threonine kinase. It regulates various cellular pathways such as insulin signalling, eIF4e and p70S6 kinase activation for protein synthesis, HIFa, VEGF, cell proliferation, nutrient and hormone signals, ribosome biogenesis, regulation of cell cycle progrssion, angiogensis, cell polarity and cytokeleton reorganization. Dysregulation in signalling that leads to constant activation of mTOR lead to uncontrolled prolifertaion and cell cycle progression and oncogensis. Increased invasiveness has also be shown do be associated with mTOR activity. While it features a wide range of mutations, this might reflect the very large size of the protein rather than its identification as a tumour suppressor protein.

Anti-MST3 Antibody (pThr190)

Anti-MST3 Antibody (pThr190)__Rabbit Anti-Human MST3 (pThr190) Polyclonal Selumetinib

Product Name MST3 Antibody (pThr190)

Description
Rabbit Anti-Human MST3 (pThr190) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Thr190 of human MST3 (AA187-193)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 49.308 kDa.

Cite This Product Rabbit Anti-Human MST3 (pThr190) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1033)

Certificate of Analysis A 1:250 dilution of SPC-1033 was sufficient for detection of MST3 (pThr190) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

Alternative Names Mammalian STE20-like protein kinase 3 antibody, Mammalian sterile 20-like 3 antibody, MST-3 antibody, MST3/C antibody, MST3/N antibody, MST3B antibody, serine threonine kinase 24 antibody, STE20 homolog yeast antibody, STE20 like kinase MST3 antibody, STE20-like kinase MST3 antibody, Stk24 antibody, STK24_HUMAN antibody, STK3 antibody

Cellular Localization Cytoplasm, Membrane, Nucleus

Accession Number NP_003567

Gene ID 8428

Swiss Prot Q9Y6E0

Anti-MST3 Antibody (pThr184)

Anti-MST3 Antibody (pThr184)__Rabbit Anti-Human MST3 (pThr184) Polyclonal VE-823

Product Name MST3 Antibody (pThr184)

Description
Rabbit Anti-Human MST3 (pThr184) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Thr184 of human MST3 (AA181-187)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 49.308 kDa.

Cite This Product Rabbit Anti-Human MST3 (pThr184) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1032)

Certificate of Analysis A 1:250 dilution of SPC-1032 was sufficient for detection of MST3 (pThr184) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

Alternative Names Mammalian STE20-like protein kinase 3 antibody, Mammalian sterile 20-like 3 antibody, MST-3 antibody, MST3/C antibody, MST3/N antibody, MST3B antibody, serine threonine kinase 24 antibody, STE20 homolog yeast antibody, STE20 like kinase MST3 antibody, STE20-like kinase MST3 antibody, Stk24 antibody, STK24_HUMAN antibody, STK3 antibody

Cellular Localization Cytoplasm, Membrane, Nucleus

Accession Number NP_003567

Gene ID 8428

Swiss Prot Q9Y6E0

MS 275

MS 275__HDAC inhibitor NVP-AUY923

Product Name MS 275

Description
HDAC inhibitor

Purity >98.5

CAS No. 209783-80-2

Molecular Formula C21H20N4O3

Molecular Weight 376.41

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble in DMSO or methanol.

Source Synthetic

Appearance Off white solid

SMILES C2=C(C(=O)NC1=C(N)C=CC=C1)C=CC(=C2)CNC(OCC3=CN=CC=C3)=O

InChI InChI=1S/C21H20N4O3/c22-18-5-1-2-6-19(18)25-20(26)17-9-7-15(8-10-17)13-24-21(27)28-14-16-4-3-11-23-12-16/h1-12H,13-14,22H2,(H,24,27)(H,25,26)

InChIKey INVTYAOGFAGBOE-UHFFFAOYSA-N

Safety Phrases Classification: D1B Toxic Material Causing Immediate and SeriousToxic Effects, Toxic by ingestion, D2A Very Toxic Material Causing Other Toxic Effects, Teratogen, D2B Toxic Material Causing Other Toxic Effects, Reproductive hazard, Moderate skin irritant, Moderate eye irritant
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.
Hazard statements:
H301 Toxic if swallowed.
H315 Causes skin irritation.
H319 Causes serious eye irritation.
H335 May cause respiratory irritation.
H360 May damage fertility or the unborn child.
Precautionary statements:
P201 Obtain special instructions before use.
P261 Avoid breathing dust/ fume/ gas/ mist/ vapours/ spray.
P301 + P310 IF SWALLOWED: Immediately call a POISON CENTER or doctor/ physician.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
P308 + P313 IF exposed or concerned: Get medical advice/ attention.

Cite This Product MS 275 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-416)

Alternative Names 3-pyridinylmethyl 4-(2-aminophenyl)aminocarbonylphenylmethylcarbamate, N-(2-Aminophenyl)-4-N-(pyridine-3ylmethoxycarbonyl)aminomethylbenzamide

Research Areas Cancer, Cell Signaling, Epigenetics

PubChem ID 4261

Scientific Background MS 275, also referred to as Entinostat, is a benzamide histone deacetylase inhibitor. It preferentially inhibits HDAC1 and HDAC3. It is currently undergoing several clinical trials for the treatment of Hodgkin's lymphoma, advanced breast cancer, and for metastatic lung cancer.

References 1. Camphausen K., Burgan W., Cerra M., Oswald K.A., Trepel J.B., Lee M.J., et al. (2004) Cancer Res. 316-21.

Montelukast sodium

Montelukast sodium__Leukotriene CysLT1 antagonist SJG-137

Product Name Montelukast sodium

Description
Leukotriene CysLT1 antagonist

Purity >98% (HPLC); NMR (conforms)

CAS No. 151767-02-1

Molecular Formula C35H35ClNO3S • Na

Molecular Weight 608.2

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Antagonist

Solubility Soluble in DMSO (50 mg/ml), or water (30 mg/ml), or ethanol (60 mg/ml)

Source Synthetic

Appearance Powder

SMILES CC(C)(O)C(C=CC=C1)=C1CCemail protected(SCC2(CC2)CC(O-)=O)C3=CC(/C=C/C4=NC5=CC(Cl)=CC=C5C=C4)=CC=C3.Na+

InChI 1S/C35H36ClNO3S.Na/c1-34(2,40)30-9-4-3-7-25(30)13-17-32(41-23-35(18-19-35)22-33(38)39)27-8-5-6-24(20-27)10-15-29-16-12-26-11-14-28(36)21-31(26)37-29;/h3-12,14-16,20-21,32,40H,13,17-19,22-23H2,1-2H3,(

InChIKey LBFBRXGCXUHRJY-YBGTYPRZSA-M

Safety Phrases Classification:
D2A Very Toxic Material Causing Other Toxic Effects – Reproductive hazard
E Corrosive Material – Corrosive to skin

Hazard statement(s):
H318 Causes serious eye damage.
H361fd Suspected of damaging fertility. Suspected of damaging the unborn child.

Precautionary statement(s):
P280 Wear protective gloves/ eye protection/ face protection.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.

Cite This Product Montelukast sodium (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-538)

Alternative Names 1-(1R)-1-3-(1E)-2-(7-chloro-2-quinolinyl)ethenylphenyl-3-2-(1-hydroxy-1-methylethyl)phenylpropylthio-methyl-cyclopropaneacetic acid, monosodium salt, Montelukast sodium, Montelukast monosodium salt, MK-0476, MK-476, KS-1087

Research Areas Immunology, Innate Immunity, Macrophage

PubChem ID 23663996

Scientific Background Montelukast is a cysteinyl leukotriene receptor 1 (CysLT1) antagonist. It blocks pentylenetetrazole-induced seizures, blood brain barrier disruption and leukocyte migration in mice.

Anti-MOK Antibody (pThr159+pTyr161)

Anti-MOK Antibody (pThr159+pTyr161)__Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal Dinaciclib

Product Name MOK Antibody (pThr159+pTyr161)

Description
Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Thr159 and Tyr161 of human MOK (AA156-163)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 48.014 kDa.

Cite This Product Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1030)

Certificate of Analysis A 1:250 dilution of SPC-1030 was sufficient for detection of MOK (pThr159+pTyr161) in 10 µg of 293T cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

Alternative Names MAPK/MAK/MRK overlapping kinase antibody, MOK antibody, MOK protein kinase antibody, MOK_HUMAN antibody, RAGE 1 antibody, RAGE antibody, Renal cell carcinoma antigen (MOK protein kinase) antibody, Renal tumor antigen 1 antibody, STK30 antibody

Cellular Localization Cytoplasm

Accession Number NP_055041

Gene ID 5891

Swiss Prot Q9UQ07

Mn SOD Protein

Mn SOD Protein__Human Recombinant Mn SOD Protein ML RR-S3 CDA

Product Name Mn SOD Protein

Description
Human Recombinant Mn SOD Protein

Applications ,
WB
,
SDS-PAGE

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Nature Recombinant

Species Human

Expression System E. coli

Amino Acid Sequence MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Purity >90%

Storage Buffer 50mM Tris/HCl pH7.7, 0.15M NaCl, 5mM DTT, 10% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~25 kDa

Cite This Product Human Recombinant Mn SOD Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-131)

Certificate of Analysis This product has been certified >90% pure using SDS-PAGE analysis.

Alternative Names Manganese SOD Protein, IPO B Protein, Mn SOD Protein, SOD2 Protein, Superoxide Dismutase (Mn) mitochondrial protein

Research Areas Cancer, Cell Signaling, Chaperones, Oxidative Stress, Trafficking

Cellular Localization Mitochondrion Matrix

Accession Number BC070913

Gene ID 24787

Swiss Prot P04179

Scientific Background Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).

References 1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102.
2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180.
3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6.
4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925.
5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385.
6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180.
7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495.
8. Wispe J.R., et al. (1989) BBA. 994: 30-36.

Mn SOD Protein

Mn SOD Protein__Rat Recombinant Mn SOD Protein RSL3 (1S,4R-)

Product Name Mn SOD Protein

Description
Rat Recombinant Mn SOD Protein

Applications ,
WB
,
SDS-PAGE

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Nature Recombinant

Species Rat

Expression System E. coli

Purity >90%

Storage Buffer 50mM Tris/HCl pH7.7, 0.3M NaCl

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~25 kDa

Cite This Product Rat Recombinant Mn SOD Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-130)

Certificate of Analysis This product has been certified >90% pure using SDS-PAGE analysis.

Other Relevant Information No leader sequence

Alternative Names Manganese SOD Protein, IPO B Protein, Mn SOD Protein, SOD2 Protein, Superoxide Dismutase (Mn) mitochondrial protein

Research Areas Cancer, Cell Signaling, Chaperones, Oxidative Stress, Trafficking

Cellular Localization Mitochondrion Matrix

Accession Number BC070913

Gene ID 24787

Swiss Prot P07895

Scientific Background Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).

References 1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102.
2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180.
3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6.
4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925.
5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385.
6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180.
7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495.
8. Wispe J.R., et al. (1989) BBA. 994: 30-36.

Anti-MMP9 Antibody S51-82

Anti-MMP9 Antibody
S51-82__Mouse Anti-Rat MMP9 Monoclonal IgG2a AZD-7763

Product Name MMP9 Antibody

Description
Mouse Anti-Rat MMP9 Monoclonal IgG2a

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
IHC
,
ICC/IF
,
IP
,
FCM

Antibody Dilution WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Host Species Mouse

Immunogen Species Rat

Immunogen Fusion protein amino acids 1-708 (full length) of rat MMP9

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein G Purified

Clonality Monoclonal

Clone Number S51-82

Isotype IgG2a

Specificity Detecs ~92kDa and ~82kDa (pro and active forms).

Cite This Product Mouse Anti-Rat MMP9 Monoclonal, Clone S51-82 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SMC-396)

Certificate of Analysis 1 µg/ml of SMC-396 was sufficient for detection of MMP9 in 20 µg of COS-1 cells (lysate) transfected with human MMP9 by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Alternative Names MMP-9 Antibody, CLG4B Antibody, 82kDa matrix metalloproteinase-9 Antibody, collagenease type 4 beta Antibody, GELB Antibody, Macrophage gelatinase Antibody, MANDP2 Antibody, Type V collagenase Antibody, 92 kDa gelatinase Antibody, 92 kDa type IV collagenase Antibody, Gelatinase B Antibody, MMP9 Antibody, Matrix metalloproteinase 9 Antibody

Research Areas Cancer, Apoptosis, Cardiovascular System, Cell Signaling, Neuroscience

Cellular Localization Extracellular Matrix

Accession Number NP_112317.1

Gene ID 81687

Swiss Prot P50282

Scientific Background MMP9, otherwise known as matrix metalloproteinase 9, is involved in the breakdown of extracellular matrix in normal physiological processes such as embryonic development, reproduction and tissue remodeling, as well as in disease processes like arthritis and metastasis (1). Among the family members, MMP-2, MMP-3, MMP-7 and MMP-9 have been characterized as important factors for normal tissue remodeling during embryonic development, wound healing, tumor invasion, angiogenesis, carcinogenesis and apoptosis (2-4). MMP activity correlates with cancer development (2). One mechanism of MMP regulation is transcriptional (5). Once synthesized, MMP exists as a latent proenzyme. Maximum MMP activity requires proteolytic cleavage to generate active MMPs by releasing the inhibitory propeptide domain from the full length protein (5).

References 1. Hirose Y., et al. (2008) Am J Hum Genet. 82(5): 1122-1129.
2. Coussens L.M., et al. (2002) Science 295: 2387-2391.
3. Sternlicht M.D., et al. (1999) Cell 98: 137-146.
4. Vu T.H., et al. (1998) Cell 93: 411-422.
5. Nagase H., et al. (1990) Biochemistry 29: 5783-5789.