Tankyrase-tankyrase.com

Anti-AKT1 Antibody (pThr308)

Anti-AKT1 Antibody (pThr308)__Rabbit Anti-Human AKT1 (pThr308) Polyclonal BLZ945

Product Name AKT1 Antibody (pThr308)

Description
Rabbit Anti-Human AKT1 (pThr308) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Thr308 of human Akt1 (AA305-311)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 55.686 kDa.

Cite This Product Rabbit Anti-Human AKT1 (pThr308) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-910)

Certificate of Analysis A 1:250 dilution of SPC-910 was sufficient for detection of AKT1 (pThr308) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112495

Alternative Names AKT1 Antibody, AKT1_Human Antibody, PKB Antibody, Protein Kinase B Alpha Antibody, RAC Antibody

Cellular Localization Cytoplasm, Cell membrane, Nucleus

Accession Number NP_005154

Gene ID 207

Swiss Prot P31749

Scientific Background AKT1 is a protein-serine/threonine kinase which is inactive in the cytoplasm. When PI3K is activated by extracellular growth factors, AKT1 is recruited to the cell membrane and phosphorylated to become active. This leads to the induction of survival, proliferation, angiogenesis and metabolism pathways. AKT1 is also involved in cell-cycle progression via its inhibitory phosphorylation of cyclin-dependent kinases and activatory phosphorylation of mTOR. Upregulation of the PI3K/AKT pathways has been implicated in a variety of cancers.

Anti-AKT1 Antibody

Anti-AKT1 Antibody__Rabbit Anti-Human AKT1 Polyclonal Pacritinib

Product Name AKT1 Antibody

Description
Rabbit Anti-Human AKT1 Polyclonal

Species Reactivity Human, Mouse

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide of human Akt1 (AA133-147)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 55.716 kDa.

Cite This Product Rabbit Anti-Human AKT1 Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1100)

Certificate of Analysis A 1:250 dilution of SPC-1100 was sufficient for detection of AKT1 in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112489

Alternative Names AKT1 Antibody, AKT1_Human Antibody, PKB Antibody, Protein Kinase B Alpha Antibody, RAC Antibody

Cellular Localization Cytoplasm, Cell membrane, Nucleus

Accession Number NP_005154

Gene ID 207

Swiss Prot P31749

Scientific Background AKT1 is a protein-serine/threonine kinase which is inactive in the cytoplasm. When PI3K is activated by extracellular growth factors, AKT1 is recruited to the cell membrane and phosphorylated to become active. This leads to the induction of survival, proliferation, angiogenesis and metabolism pathways. AKT1 is also involved in cell-cycle progression via its inhibitory phosphorylation of cyclin-dependent kinases and activatory phosphorylation of mTOR. Upregulation of the PI3K/AKT pathways has been implicated in a variety of cancers.

AICAR

AICAR__Autophagy inducer TEPP-46

Product Name AICAR

Description
Autophagy inducer

Purity >99% (TLC), NMR conforms

CAS No. 2627-69-2

Molecular Formula C9H14N4O5

Molecular Weight 258.2

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inducer

Solubility Soluble to 75 mM in water and to 75 mM in DMSO.

Source Synthetic

Appearance Off-white solid.

SMILES [C@@H]2([N]1C(=C(C(N)=O)N=C1)N)O[[email protected]function(t,e,r,n,c,a,p){try{t=document.currentScript||function(){for(t=document.getElementsByTagName(_script_),e=t.length;e–;)if(t[e].getAttribute(_data-cfhash_))return t[e]}();if(t&&(c=t.previousSibling)){p=t.parentNode;if(a=c.getAttribute(_data-cfemail_)){for(e=__,r=_0x_+a.substr(0,2)|0,n=2;a.length-n;n+=2)e+=_%_+(_0_+(_0x_+a.substr(n,2)^r).toString(16)).slice(-2);p.replaceChild(document.createTextNode(decodeURIComponent(e)),c)}p.removeChild(t)}}catch(u){}}()/* ]]> /](CO)[[email protected]function(t,e,r,n,c,a,p){try{t=document.currentScript||function(){for(t=document.getElementsByTagName(_script_),e=t.length;e–;)if(t[e].getAttribute(_data-cfhash_))return t[e]}();if(t&&(c=t.previousSibling)){p=t.parentNode;if(a=c.getAttribute(_data-cfemail_)){for(e=__,r=_0x_+a.substr(0,2)|0,n=2;a.length-n;n+=2)e+=_%_+(_0_+(_0x_+a.substr(n,2)^r).toString(16)).slice(-2);p.replaceChild(document.createTextNode(decodeURIComponent(e)),c)}p.removeChild(t)}}catch(u){}}()/ ]]> /]([[email protected]function(t,e,r,n,c,a,p){try{t=document.currentScript||function(){for(t=document.getElementsByTagName(_script_),e=t.length;e–;)if(t[e].getAttribute(_data-cfhash_))return t[e]}();if(t&&(c=t.previousSibling)){p=t.parentNode;if(a=c.getAttribute(_data-cfemail_)){for(e=__,r=_0x_+a.substr(0,2)|0,n=2;a.length-n;n+=2)e+=_%_+(_0_+(_0x_+a.substr(n,2)^r).toString(16)).slice(-2);p.replaceChild(document.createTextNode(decodeURIComponent(e)),c)}p.removeChild(t)}}catch(u){}}()/ ]]> */]2O)O

InChI InChI=1S/C9H14N4O5/c10-7-4(8(11)17)12-2-13(7)9-6(16)5(15)3(1-14)18-9/h2-3,5-6,9,14-16H,1,10H2,(H2,11,17)/t3-,5-,6-,9-/m1/s1

InChIKey RTRQQBHATOEIAF-UUOKFMHZSA-N

Safety Phrases Classification: D2B- Toxic Material Causing Other Toxic Effects, Moderate skin irritant, Moderate respiratory irritant, Moderate eye irritant
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.
Hazard statements:
H315- Causes skin irritation.
H319- Causes serious eye irritation.
H335- May cause respiratory irritation.
Precautionary statements:
P261- Avoid breathing dust/ fume/ gas/ mist/ vapours/ spray.
P264- Wash skin thoroughly after handling.
P271- Use only outdoors or in a well-ventilated area.
P280- Wear protective gloves/ eye protection/ face protection.
P302 + P352- IF ON SKIN: Wash with plenty of soap and water.
P304 + P340- IF INHALED: Remove victim to fresh air and keep at rest in a position comfortable for breathing.
P305 + P351 + P338- IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
P312- Call a POISON CENTER or doctor/ physician if you feel unwell.
P321- Specific treatment (see supplemental first aid instructions on this label).
P332 + P313- If skin irritation occurs: Get medical advice/ attention.
P337 + P313- If eye irritation persists: Get medical advice/ attention.
P362- Take off contaminated clothing and wash before reuse.
P403 + P233- Store in a well-ventilated place. Keep container tightly closed.
P405- Store locked up.
P501- Dispose of contents/ container to an approved waste disposal plant.

Cite This Product AICAR (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-402)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112401

Alternative Names N1-(β-D-Ribofuranosyl)-5-aminoimidazole-4-carboxamide

Research Areas Cancer, Autophagy

PubChem ID 17513

Scientific Background AICAR is an adenosine analog that when phosphorylated forms 5-aminoimidazole-4-carboxamide-1-D-ribofuranosyl-5’-monophosphate (ZMP) which proceeds to activate adenosine monophosphate-activated protein kinase (AMPK). This process in turn stimulates glucose uptake by skeletal muscle in an insulin-dependent manner. Autophagy is initiated by the UNC-51-like kinase 1/2 complex (ULK1 and ULK2). Under basal conditions, autophagy is negatively regulated due to the phosphorylation of ULK1 at serine-757 by mTORC1. During starvation, autophagy is positively regulated by ULK1/2 when it is phosphorylated at serine-555 and serine-777 by AMPK. Therefore, the activation of AMPK by AICAR, in turn will induce autophagy.

References 1. Jhun B.S., et al. (2004) Biochem Biophys Res Commun. 318(2): 372-80.
2. Huang H., et al. (2013) Autophagy. 9(2): 175-95.

AHA2 Protein

AHA2 Protein__Mouse Recombinant AHA2 Protein Siponimod

Product Name AHA2 Protein

Description
Mouse Recombinant AHA2 Protein

Applications ,
WB
,
SDS-PAGE
,
Functional Assay

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Mouse

Expression System E. coli

Amino Acid Sequence MGHHHHHHMAKWGQGDPRWIVEEREDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGDGEILKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAVATQELTLQRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA

Purity >90%

Storage Buffer 25mM Trif buffer pH7.2, 150mM NaCl, 0.1mM DTT, 50% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~38 kDa

Cite This Product Mouse Recombinant AHA2 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-313)

Certificate of Analysis This product has been certified >90% pure using SDS – PAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112397

Alternative Names ATPase hydrogen-exporting ATPase 2 Protein, Activator of 90 kDa heat shock protein ATPase homolog 2 protein, Ahsa2 protein

Research Areas Cancer, Heat Shock

Accession Number NM_172391.3

Gene ID 268390

Swiss Prot Q8N9S3

Scientific Background Aha2 shares 45% sequence homology with Aha1, however, little is known about the functional protein. Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

AHA2 Protein

AHA2 Protein__Human Recombinant AHA2 Protein Palbociclib (isethionate)

Product Name AHA2 Protein

Description
Human Recombinant AHA2 Protein

Applications ,
WB
,
SDS-PAGE

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Human

Expression System E. coli

Purity >90%

Storage Buffer 100mM NaH2 pH4.5, 10mM Tris buffer with 8M urea

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~38 kDa

Cite This Product Human Recombinant AHA2 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-312)

Certificate of Analysis This product has been certified >90% pure using SDS – PAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112388

Alternative Names ATPase hydrogen-exporting ATPase 2 Protein, Activator of 90 kDa heat shock protein ATPase homolog 2 protein, AHSA2 protein

Research Areas Cancer, Heat Shock

Accession Number NP_036243.1

Gene ID 130872

Swiss Prot Q719I0

Scientific Background Aha2 shares 45% sequence homology with Aha1, however, little is known about the functional protein. Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

Anti-AHA2 Antibody

Anti-AHA2 Antibody__Rabbit Anti-Human AHA2 Polyclonal AZD-9291

Product Name AHA2 Antibody

Description
Rabbit Anti-Human AHA2 Polyclonal

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
ICC/IF

Antibody Dilution WB (1:1000), ICC/IF (1:80); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Aha2

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Storage Buffer PBS pH 7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein A purified

Clonality Polyclonal

Specificity Cross reacts with Aha1.

Cite This Product Rabbit Anti-Human AHA2 Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-196)

Certificate of Analysis 1 µg/ml of SPC-196 was sufficient for detection of Aha2 in 20 µg of rat tissue lysate by colorimetric immunoblot analysis using Goat anti-rat IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112384

Alternative Names ATPase hydrogen-exporting ATPase 2 Antibody

Research Areas Cancer, Heat Shock

Accession Number NP_689605.1

Gene ID 130872

Swiss Prot Q719I0

Scientific Background The Arabidopsis protein RIN4 is a well known regulator of plant immunity. The plasma membrane H+-ATPases Aha1 and Aha2 are one class of RIN4-associated proteins (1-5). Aha1 and Aha2 play a crucial role in resisting pathogen invasion- plants use RIN4 to regulate H+-ATPase activity during immune responses, thereby controlling stomatal apertures during pathogen attack (1). Wild type AHA2 has been found to be localized to the plasma membrane, and has also been found in the ER (4).

References 1. Liu J., Elmore J.M., and Coaker G. (2009) Plant Signal Behav. 4(12): 1107-1110.
2. Harper J.F., Surowy T.K. and Sussman M.R. (1989) Proc Natl Acad. Sci USA . 86: 1234-1238.
3. Harper J. F., et al. (1990) J Biol Chem. 265: 13601-13608.
4. Harper J.F., Manney L., and Sussman M.R. (1994) Mol Gen Genet. 243: 572-587.
5. Regenberg B., Villalba J.M., Lanfermeijer F.C., and Palmgren M.G. (1995) Plant Cell. 7: 1655-1666.

Anti-AHA1p Antibody

Anti-AHA1p Antibody__Rabbit Anti-Yeast AHA1p Polyclonal MK-1775

Product Name AHA1p Antibody

Description
Rabbit Anti-Yeast AHA1p Polyclonal

Species Reactivity Yeast

Applications ,
WB

Antibody Dilution WB (1:2500); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Yeast

Immunogen Yeast Aha1 raised against peptide (CESQVKSNYTRGNQK)-KLH fusion

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Storage Buffer Rabbit Antiserum, PBS, 50% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Rabbit antiserum

Clonality Polyclonal

Specificity Detects ~38kDa. Can run up to 45kDa on SDS Page.

Cite This Product Rabbit Anti-Yeast AHA1p Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-204)

Certificate of Analysis 0.5 µg/ml of SPC-204 was sufficient for detection of Aha1p in 20 µg of W303 yeast lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112236

Alternative Names Activator of 90 kDa heat shock protein ATPase homolog 1 Antibody, Aha1 Antibody, SHSA1 Antibody, HSPC322 Antibody, p38 Antibody

Research Areas Cancer, Heat Shock, Cell Signaling, Chaperones, Trafficking

Cellular Localization Cytoplasm, Endoplasmic Reticulum

Accession Number NP_010500.3

Gene ID 851800

Swiss Prot Q12449

Scientific Background Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

AHA1 Protein

AHA1 Protein__Yeast Recombinant AHA1 Protein MLN4924

Product Name AHA1 Protein

Description
Yeast Recombinant AHA1 Protein

Applications ,
WB
,
SDS-PAGE
,
Functional Assay

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Yeast

Expression System E. coli

Amino Acid Sequence MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL

Purity >90%

Storage Buffer 12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~405 kDa

Cite This Product Yeast Recombinant AHA1 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-314)

Certificate of Analysis This product has been certified >90% pure using SDS – PAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112222

Alternative Names Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein

Research Areas Cancer, Heat Shock, Cell Signaling, Chaperones, Trafficking

Cellular Localization Cytoplasm

Accession Number NM_001180522.1

Gene ID 851800

Swiss Prot Q12449

Scientific Background Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

AHA1 Protein

AHA1 Protein__Mouse Recombinant AHA1 Protein VT-464

Product Name AHA1 Protein

Description
Mouse Recombinant AHA1 Protein

Applications ,
WB
,
SDS-PAGE
,
Functional Assay

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Mouse

Expression System E. coli

Amino Acid Sequence MGHHHHHHMAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTEKLKTLFLAVRVENEEGKCEVTEVNKLDGEASINNRKGKLIFFYEWTIKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEDGVKLLREAVGIYISTLKTEFTQGMILPTVNGESVDPVGQPALKTETCKAKSAPSKSQAKPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPAALEADRGGKFHMVDGNVTGEFTDLVPEKHIAMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

Purity >90%

Storage Buffer 25mM Hepes buffer pH7.2, 100mM KoAc, 50% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~38 kDa

Cite This Product Mouse Recombinant AHA1 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-311)

Certificate of Analysis This product has been certified >90% pure using SDS-PAGE analysis. 2uM SPR-311 generated a 9-fold ATPase activation of 2uM HSP90 (His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm.)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112174

Alternative Names Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein

Research Areas Cancer, Heat Shock, Cell Signaling, Chaperones, Trafficking

Cellular Localization Cytoplasm

Accession Number NP_666148.1

Gene ID 217737

Swiss Prot Q8BK64

Scientific Background Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

AHA1 Protein

AHA1 Protein__Human Recombinant AHA1 Protein Olaparib

Product Name AHA1 Protein

Description
Human Recombinant AHA1 Protein

Applications ,
WB
,
SDS-PAGE
,
Functional Assay

Concentration Lot/batch specific. See included datasheet.

Conjugates His tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Human

Expression System E. coli

Amino Acid Sequence SHMAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

Purity >90%

Storage Buffer 20mM HEPES buffer pH7.2, 80mM NaCl, 10% glycerol

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Specificity ~38 kDa

Cite This Product Human Recombinant AHA1 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-309)

Certificate of Analysis This product has been certified >90% pure using SDS PAGE analysis. 2uM SPR-309 generated a 9-fold ATPase activation of 2uM HSP90 (His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm.)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19112163

Alternative Names Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein

Research Areas Cancer, Heat Shock, Cell Signaling, Chaperones, Trafficking

Cellular Localization Cytoplasm

Accession Number NP_036243.1

Gene ID 10598

Swiss Prot O95433

Scientific Background Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.