Tankyrase-tankyrase.com

Anti-Cytochrome P450 Reductase Antibody

Anti-Cytochrome P450 Reductase Antibody__Rabbit Anti-Rat Cytochrome P450 Reductase Polyclonal Bortezomib

Product Name Cytochrome P450 Reductase Antibody

Description
Rabbit Anti-Rat Cytochrome P450 Reductase Polyclonal

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
IHC
,
ICC/IF

Antibody Dilution WB (1:1000), ICC/IF (1:60); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Rat

Immunogen Rat native full-length Cytochrome P450 Reductase purified from liver tissue

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH 7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein A purified

Clonality Polyclonal

Specificity Detects ~77kDa.

Cite This Product Rabbit Anti-Rat Cytochrome P450 Reductase Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-210)

Certificate of Analysis 1 µg/ml of SPC-210 was sufficient for detection of Cytochrome P450 in 10 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120092

Alternative Names Cytochrome C Reductase Antibody, CCR Antibody, CPR Antibody, P450R Antibody, CYPOR Antibody, DKFZp686G04235 Antibody, FLJ26468 Antibody, NADPH Cytochrome Antibody, P450 Reductase Antibody, NADPH dependent cytochrome P450 reductase Antibody, NADPH-cytochrome P450 reductase Antibody, P450 (cytochrome) oxidoreductase Antibody, P450 Cytochrome Oxidoreductase Antibody, P450R Antibody, POR Antibody

Research Areas Cancer, Heat Shock, Cardiovascular System

Cellular Localization Endoplasmic Reticulum, Endoplasmic reticulum membrane, Microsome

Accession Number NP_113764.1

Gene ID 29441

Swiss Prot P00388

Scientific Background Cytochrome P450 Reductase is an enyme that is required for the transfer of electrons from NADPH to cytochrome P450 in microsomes. It has also been found to transfer electrons to Heme oxygenase and cytochrome B5. Cytochrome P450 Reductase is found localized to the endoplasmic reticulum membrane, tethered by its hydrophobic N-terminal tail. Mutations in the gene encoding Cytochrome P450 Reductase (POR) have been found to cause congenital adrenal hyperplasia, Antley-Bixler syndrome, amenorrhea and disordered steroidogenesis.

References 1. Pandey A.V. and Flück C.E. (2013). Pharmacology & therapeutics 138 (2): 229–54.
2. Jensen K. and Møller BL (2010). Phytochemistry 71 (2-3): 132–41.
3. Flück C.E. et al. (2004). Nature Genetics 36 (3): 228–230.

Cytochalasin D

Cytochalasin D__Actin polymerization inhibitor SCH772984

Product Name Cytochalasin D

Description
Actin polymerization inhibitor

Purity >98% (TLC); NMR (Conforms)

CAS No. 22144-77-0

Molecular Formula C30H37NO6

Molecular Weight 507.63

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble to 10 mM in ethanol and to 50 mM in DMSO

Source Synthetic

Appearance White Solid

SMILES Cemail protected1C/C=C/email protected2C@@H(C(=C)email protected(C@@H3C@@2(C@@H(/C=C/email protected(C1)C)OC(=O)C)C(=O)Nemail protected3CC4=CC=CC=C4)C)O

InChI InChI=1S/C30H37NO6/c1-17-10-9-13-22-26(33)19(3)18(2)25-23(16-21-11-7-6-8-12-21)31-28(35)30(22,25)24(37-20(4)32)14-15-29(5,3

InChIKey SDZRWUKZFQQKKV-BBXOWAOSSA-N

Safety Phrases Classification: Toxic. May be harmful or fatal if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
Risk Phrases:
R62 – Possible risk of impaired fertility
R68 – Possible risk of irreversible effects
Hazard Phrases:
H300-H361
Precautionary Phrases:
P264-P281-P301 + P310

Cite This Product Cytochalasin D (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-241)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120088

Alternative Names (3S,3aR,4S,6S,6aR,7E,10S,12S,13E,15R,15aR)-3-Benzyl-6-hydroxy-4,10,12-trimethyl-5-methylene-1-oxo-2,3,3a,4,5,6,6a,9,10,11,12,15-dodecahydro-1H-cycloundecadisoindol-15-yl acetate, Zygosporin A

Research Areas Cancer, Apoptosis

PubChem ID 5458428

Scientific Background Cytochalasins have the ability to bind to actin filaments and block polymerization and elongation of actin. As a result, they can change cellular morphology, inhibit cellular processes and cause cells to undergo apoptosis (1). Cytochalasin D in particular can inhibit protein synthesis (2).

References 1. Haidle A., and Myers A. (2004) Proc Natl Acad Sci. 101(33): 12048-12053.
2. Ornelles et al., (1986) Mol Cell Biol. 6(5): 1650-1662.

Cyclosporine

Cyclosporine__Immunosuppressant CUDC-907

Product Name Cyclosporine

Description
Immunosuppressant

Purity >99%

CAS No. 59865-13-3

Molecular Formula C62H111N11O12

Molecular Weight 1202.63

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble to 100 mM in DMSO, 50 mM in ethanol

Source Synthetic

Appearance White Solid

SMILES CCemail protected1C(=O)N(CC(=O)N(email protected(C(=O)Nemail protected(C(=O)N(email protected(C(=O)Nemail protected(C(=O)NC@@H(C(=O)N(email protected(C(=O)N(email protected(C(=O)N(email protected(C(=O)N(email protected(C(=O)N1)C@@H(email protected(C)C/C=C/C)O)C)C(C)C)C)CC(C)C)C)CC(C)C)C)C)C)CC(

InChI InChI=1S/C62H111N11O12/c1-25-27-28-40(15)52(75)51-56(79)65-43(26-2)58(81)67(18)33-48(74)68(19)44(29-34(3)4)55(78)66-49(38(11)12)61(84)69(20)45(

InChIKey PMATZTZNYRCHOR-IMVLJIQESA-N

Safety Phrases Classification: Toxic. May be harmful or fatal if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
S45 – In case of accident or if you feel unwell, seek medical advice immediately (show the label where possible)
Risk Phrases:
R20/21/22 – Harmful by inhilation, in contact with skin and if swallowed
R45 – May cause cancer
R62 – Possible risk of impaired fertility
R68 – Possible risk of irreversible effects
Hazard Phrases:
H302-H350-H360
Precautionary Phrases:
P201-P308 + P313

Cite This Product Cyclosporine (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-201)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120072

Alternative Names (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-Ethyl-33-(1R,2R,4E)-1-hydroxy-2-methyl-4-hexen-1-yl-6,9,18,24-tetraisobutyl-3,21-diisopropyl-1,4,7,10,12,15,19,25,28-nonamethyl-1,4,7,10,13,16,19,22,25,28,3 1-undecaazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone, Cyclosporin A

Research Areas Cancer, Apoptosis

PubChem ID 5284373

Scientific Background Cyclosporin A is a hydrophobic cyclic peptide, and is a potent immune-suppressant and antifungal. It acts via its ability to bind to a family of intracellular proteins (1). The immunosuppressant action is mediated by the complex Cyclosporin-A-cyclophilin that specifically inhibits the Ca2+/calmodulin-dependent serine-threonine-protein phosphatase-2B. This is turn inhibits calcineurin and promotes dephosphorylation of transcription factor NF-AT and T-cell activation (2).

References 1. Heitman J., et al. (1992) New Biol. 4:448.
2. Ganong W.F. Review of Medical Physiology, 22nd edition. Lange Medical Books, Chapter 27, Page 530.

Cyclopamine

Cyclopamine__Hedgehog signaling blocker Vanoxerine

Product Name Cyclopamine

Description
Hedgehog signaling blocker

Purity >98%

CAS No. 4449-51-8

Molecular Formula C27H41NO2

Molecular Weight 434.15

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble to 5 mM in ethanol

Source Synthetic

Appearance White Solid

SMILES Cemail protected1CC@@H2email protected(email protected(C@3(O2)CCemail protected4C@@H5CC=C6Cemail protected(CCC@@6(email protected5CC4=C3C)C)O)C)NC1

InChI InChI=1S/C27H41NO2/c1-15-11-24-25(28-14-15)17(3)27(30-24)10-8-20-21-6-5-18-12-19(29)7-9-26(18,4)23(21)13-22(20)16(27)2/h5,15,17

InChIKey QASFUMOKHFSJGL-LAFRSMQTSA-N

Safety Phrases Classification: Harmful. May be harmful if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
Risk Phrases:
R62- Possible risk of impaired fertility

Cite This Product Cyclopamine (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-226)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120058

Alternative Names (3β,22S,23R)-17,23-Epoxyveratraman-3-ol

Research Areas Cancer, Apoptosis, Cancer Growth Inhibitors, Hedgehog Pathway Blocker

PubChem ID 442972

Scientific Background Cyclopamine is a hedgehog signaling pathway inhibitor that influences the balance between the active and inactive forms of the Smoothened protein (1). It is being investigated as a treatment agent in basal cell carcinoma, medulloblastoma and rhabdomyosarcoma (1, 2).

References 1. Beachy P.A., et al. (2000) Nature. 406(6799): 1005-1009.
2. Yauch R.L., et al. (2009) Science. 326(5952): 572-574.

Anti-Cyclooxygenase 1 Antibody

Anti-Cyclooxygenase 1 Antibody__Rabbit Anti-Human Cyclooxygenase 1 Polyclonal Galanthamine

Product Name Cyclooxygenase 1 Antibody

Description
Rabbit Anti-Human Cyclooxygenase 1 Polyclonal

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
ICC/IF

Antibody Dilution WB (1:1000); ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide of Human Cyclooxygenase

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects ~75 kDa.

Cite This Product Rabbit Anti-Human Cyclooxygenase 1 Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-707)

Certificate of Analysis A 1:1000 dilution of SPC-707 was sufficient for detection of Cyclooxygenase in 15 µg of Human HeLa Cell Lysates by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120039

Alternative Names EC:1.14.99.1 Antibody, PGHS1 Antibody, Prostaglandin G/H synthase 1 Antibody, PGHS-1 Antibody, Prostaglandin H2 synthase 1 Antibody, Prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) Antibody, PHS 1 Antibody, EC 1.14.99.1 Antibody, Prostaglandin-endoperoxide synthase 1 Antibody, COX 3 Antibody, PTGS1 Antibody, PGH1_HUMAN Antibody, COX-1 Antibody, PGG/HS Antibody, PTGHS Antibody, Cox3 Antibody, PGH synthase 1 Antibody, Cyclooxygenase-1 Antibody, PHS1 Antibody, Cyclooxygenase 1 Antibody, Cyclooxygenase 3, included Antibody, Partial COX1 proteins, included Antibody, COX 1 Antibody, COX1 Antibody, PCOX1 Antibody

Cellular Localization Endoplasmic reticulum membrane, Microsome Membrane, Peripheral membrane protein

Accession Number NP_000953.2

Gene ID 5742

Swiss Prot P23219

Cycloheximide

Cycloheximide__Translation inhibitor Verteporfin

Product Name Cycloheximide

Description
Translation inhibitor

Purity >98%

CAS No. 66-81-9

Molecular Formula C15H23NO4

Molecular Weight 281.35

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble to 50 mM in Ethanol and 25 mM in water

Source Synthetic

Appearance White solid

SMILES Cemail protected1CC@@H(C(=O)C@@H(C1)C@@H(CC2CC(=O)NC(=O)C2)O)C

InChI InChI=1S/C15H23NO4/c1-8-3-9(2)15(20)11(4-8)12(17)5-10-6-13(18)16-14(19)7-10/h8-12,17H,3-7H2,1-2H3,(H,16,18,19)/t8-,9-,11-,12

InChIKey YPHMISFOHDHNIV-FSZOTQKASA-N

Safety Phrases Classification: Very toxic. May be fatal if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
S45 – In case of accident or if you feel unwell, seek medical advice immediately (show the label where possible)
Risk Phrases:
R26/27/28 – Very Toxic by inhalation, in contact with skin and if swallowed
R62 – Possible risk of impaired fertility
R68- Possible risk of irreversible effects
Hazard Phrases:
H300-H341-H360D-H411
Precautionary Phrases:
P201-P264-P273-P281-P301 + P310-P308 + P313

Cite This Product Cycloheximide (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-247)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120021

Alternative Names 4-{(2R)-2-(1S,3S,5S)-3,5-Dimethyl-2-oxocyclohexyl-2-hydroxyethyl}-2,6-piperidinedione

Research Areas Cancer, Apoptosis

PubChem ID 6197

Scientific Background Selective inhibitor of eukaryotic protein synthesis blocking tRNA binding and release from ribosomes. Induces apoptosis in a variety of transformed and normal cell lines, including T-cells.

References 1. Obrig T.G., et al. (1971) J Biol Chem. 246:174.

Anti-CXCR4 Antibody

Anti-CXCR4 Antibody__Rabbit Anti-Human CXCR4 Polyclonal Temozolomide

Product Name CXCR4 Antibody

Description
Rabbit Anti-Human CXCR4 Polyclonal

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
IHC

Antibody Dilution WB (1:2000), IHC (1:200); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A synthesized peptide derived from human CXCR4

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS, pH 7.4, 50% glycerol, 150mM NaCl, 0.02% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Affinity Purified

Clonality Polyclonal

Isotype IgG

Specificity Detects ~45kDa, endogenous levels of total CXCR4.

Cite This Product Rabbit Anti-Human CXCR4 Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1293)

Certificate of Analysis A 1:1000 dilution of SPC-1293 was sufficient for detection of CXCR4 in 10 µg of K562 cell lysates by ECL immunoblot analysis using Goat Anti-Rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120021

Alternative Names C-X-C chemokine receptor type 4 Antibody, CD184 Antibody, CD184 antigen Antibody, Chemokine (C X C motif) receptor 4 Antibody, Chemokine CXC Motif Receptor 4 Antibody, CXC-R4 Antibody, CXCR-4 Antibody, CXCR4 Antibody, CXCR4_HUMAN Antibody, D2S201E Antibody, FB22 Antibody, Fusin Antibody, HM89 Antibody, HSY3RR Antibody, LAP 3 Antibody, LAP3 Antibody, LCR1 Antibody, LESTR Antibody, Leukocyte derived seven transmembrane domain receptor Antibody, Leukocyte-derived seven transmembrane domain receptor Antibody, Lipopolysaccharide associated protein 3 Antibody, Neuropeptide Y receptor Y3 Antibody, NPY3R Antibody, NPYR Antibody, NPYRL Antibody, NPYY3 Antibody, NPYY3R Antibody, Probable G protein coupled receptor lcr1 homolog Antibody, SDF 1 receptor Antibody, SDF-1 receptor Antibody, SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR Antibody, Stromal cell derived factor 1 receptor Antibody, Stromal cell-derived factor 1 receptor Antibody, WHIM Antibody

Research Areas Cancer, Neuroscience

Cellular Localization Cell Junction, Cell membrane, Early endosome, Late Endosome, Lysosome

Accession Number NP_003458.1

Gene ID 7852

Swiss Prot P61073

Scientific Background C-X-C chemokine receptor type 4 (CXCR-4) is a protein that in humans is encoded by the CXCR4 gene, also known as fusin or CD184 (cluster of differentiation 184). Chemokines and their receptors direct migration of distinct leukocyte subsets to sites of inflammation and to their specific niches in lymphoid organs. Virtually all T cell chemoattractants selectively attract memory/activated T cells. C-X-C chemokine receptor type 4 is involved in haematopoiesis and in cardiac ventricular septum formation. Plays also an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. It has been associated with WHIM syndrome. WHIM like mutations in CXCR4 were recently identified in patients with Waldenstrom's macroglobulinemia, a B-cell malignancy.

References 1. Moriuchi M. et al. (1997) Journal of Immunology 159 (9): 4322–9.
2. Caruz A. et al. (1998) FEBS Letters 426 (2): 271–8.
3. Balabanian K. et al. (2008) The Journal of Clinical Investigation 118 (3): 1074–84.
4. Hunter Z.R. et al. (2014) Blood 123 (11): 1637–46.

Bovine Serum Albumin (BSA) modified with Crotonaldehyde

Bovine Serum Albumin (BSA) modified with Crotonaldehyde__Bovine Serum Albumin (BSA) modified with Crotonaldehyde UNC0642

Product Name Crotonaldehyde BSA Conjugate

Description
Bovine Serum Albumin (BSA) modified with Crotonaldehyde

Applications ,
WB
,
ELISA

Concentration Lot/batch specific. See included datasheet.

Conjugates No tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Expression System Synthetic

Purity >98%

Storage Buffer PBS pH 7.4, 0.09% Sodium Azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Filter Sterilized (0.2 µm)

Cite This Product Synthetic Crotonaldehyde BSA Conjugate (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-207)

Certificate of Analysis Detectable in ELISA at ≥ 5 ng.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19120009

Alternative Names Crotonaldehyde BSA Conjugate, Crotonaldehyde-BSA Conjugate, Crotonaldehyde (BSA) Conjugate, CRA BSA Conjugate, CRA-modified BSA, Crotonaldehyde-modified BSA, (2E)-but-2-enal BSA Conjugate, Crotoinic aldehyde BSA Conjugate, β-Methacrolein BSA Conjugate, β-Methyl acrolein BSA Conjugate, 2-butenal BSA Conjugate, Propylene aldehyde BSA Conjugate, Crotonaldehyde Bovine Serum Albumin Conjugate, Crotonaldehyde-Bovine Serum Albumin Conjugate, Crotonaldehyde (Bovine Serum Albumin) Conjugate, CRA Bovine Serum Albumin Conjugate, CRA-modified Bovine Serum Albumin, Crotonaldehyde-modified Bovine Serum Albumin, (2E)-but-2-enal Bovine Serum Albumin Conjugate, Crotoinic aldehyde Bovine Serum Albumin Conjugate, β-Methacrolein Bovine Serum Albumin Conjugate, β-Methyl acrolein Bovine Serum Albumin Conjugate, 2-butenal Bovine Serum Albumin Conjugate, Propylene aldehyde Bovine Serum Albumin Conjugate

Research Areas Cancer, Oxidative Stress

Anti-CrkRS Antibody (pSer383 + pSer385)

Anti-CrkRS Antibody (pSer383 + pSer385)__Rabbit Anti-Human CrkRS (pSer383 + pSer385) Polyclonal GS-9620

Product Name CrkRS Antibody (pSer383 + pSer385)

Description
Rabbit Anti-Human CrkRS (pSer383 + pSer385) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Ser383 and Ser385 of human CrkRS (AA380-388)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 164.155 kDa.

Cite This Product Rabbit Anti-Human CrkRS (pSer383 + pSer385) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-941)

Certificate of Analysis A 1:250 dilution of SPC-941 was sufficient for detection of CrkRS (pSer383 + pSer385) in 10 µg of 293T cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19119976

Alternative Names arginine/serine-rich Antibody, Cdc2 related kinase arginine/serine rich Antibody, CDC2 related protein kinase 7 Antibody, Cdk12 Antibody, Cell division cycle 2 related protein kinase 7 Antibody, Cell division protein kinase 12 Antibody, CRK7 Antibody, Pksc Antibody

Cellular Localization Nucleus

Accession Number NP_057591

Gene ID 51755

Swiss Prot Q9NYV4

Scientific Background CrkRS (Cdc2-related kinase, arginine/serine-rich, also designated CRK7 and CRKR) is an ubiquitous protein that appears to localize to the nucleus and link transcription and splicing machinery. CrkRS belongs to the serine/threonine protein kinase family and Cdc2/Cdkx subfamily. CrkRS has extensive proline-rich regions that resemble SH3 and WW domain binding sites, and an RS domain that is characteristic of splicing factors. The protein kinase domain of CrkRS is 89% identical to the CHED protein kinase, also designated CDC2L5 and cell division cycle 2-like 5 (cholinesterase-related cell division controller), however outside the kinase domains the two proteins are unique. Cell cycle control kinases can phosphorylate proteins important for differentiation and apoptosis and provide connections between proliferation, differentiation, apoptosis, and neurocytoskeleton dynamics.

Cpn10 Protein

Cpn10 Protein__Human Recombinant Cpn10 Protein Plerixafor (octahydrochloride)

Product Name Cpn10 Protein

Description
Human Recombinant Cpn10 Protein

Applications ,
WB
,
SDS-PAGE

Concentration Lot/batch specific. See included datasheet.

Conjugates No tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Nature Recombinant

Species Human

Expression System E. coli

Amino Acid Sequence MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Purity >90%

Storage Buffer 20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Multi-Step Purified

Specificity ~10 kDa

Cite This Product Human Recombinant Cpn10 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-310)

Certificate of Analysis This product has been certified >90% pure using SDS-PAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/1911988

Alternative Names 10kDa Chaperonin Protein, Chaperonin 10 Protein, Cpn 10 Protein, EPF Protein, GROES Protein, Heat Shock 10kD protein1 Protein, HSP10 Protein, HSPE1 Protein

Research Areas Cancer, Heat Shock

Cellular Localization Mitochondrion Matrix

Accession Number NM_002157.2

Gene ID 3336

Swiss Prot P61604

Scientific Background Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).

References 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549.
2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460.
3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560.
4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.