Tankyrase-tankyrase.com

Anti-Calcineurin A Antibody

Anti-Calcineurin A Antibody__Rabbit Anti-Human Calcineurin A Polyclonal AZD-9291 (mesylate)

Product Name Calcineurin A Antibody

Description
Rabbit Anti-Human Calcineurin A Polyclonal

Species Reactivity Dog, Human, Mouse, Rat, Rabbit

Applications ,
WB
,
IHC
,
ICC/IF
,
IP

Antibody Dilution WB (1:1000), ICC/IF (1:120), IHC (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Human Calcineurin A peptide (AA 264-283)

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH 7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects ~61kDa.

Cite This Product Rabbit Anti-Human Calcineurin A Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-175)

Certificate of Analysis 1 µg/ml of SPC-175 was sufficient for detection of Calcineurin A in 20 µg of Heat shock Hela lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19117336

Alternative Names Alpha isoform formerly PPP2B Antibody, Calcineurin A alpha Antibody, Calcineurin A1 Antibody, CalcineurinA Antibody, Calmodulin dependent calcineurin A subunit alpha isoform Antibody, Calmodulin-dependent calcineurin A subunit alpha isoform Antibody, CALN Antibody, CALNA Antibody, CALNA 1 Antibody, CAM PRP catalytic subunit Antibody, CCN 1 Antibody, Protein phosphatase 2B catalytic subunitProtein phosphatase 3 (formerly 2B) catalytic subunit alpha isoform Antibody, Protein phosphatase 3 catalytic subunit alpha isoform PPP3CA Antibody, Protein phosphatase 3 catalytic subunit alpha isozyme Antibody, Serine/threonine protein phosphatase 2B catalytic subunit alpha isoform Antibody

Research Areas Cell Signaling, Phosphorylation, Post-translational Modifications

Cellular Localization Nucleus

Accession Number Q08209

Gene ID 5530

Swiss Prot Q08209

Scientific Background Calcineurin is a heterodimeric phosphatase protein, also known as calcium-dependent serine-threonine phosphatase. The structure consists of a catalytic subunit alpha, Calcineurin A (57-59KDa) the active site and a Ca2+ binding unit, Calcineurin B (19-20KDa) the regulatory subunit(1). Calcineurin plays a key role in the T-cell response growth and differentiation mechanism, regulating the activation of the Nuclear factor of activated T-cells (NFATc) which are important in the expression of IL-2 genes. Calcineurin has been the target of inhibitors, the novel and structural immune-suppressants antifungal drugs(2). Genetic studies in yeast and fungi established the molecular basis of the inhibition mechanism by cyclosporine A and FK506 (3).

References 1. Rusnak F. and Mertz P. (2000) Physiol Rev. 80(4):1483-521.
2. Hemenway C.S. And Heitman J. (1999)Cell Biochem Biophys. 30(1):115-51.
3. Fox D.S. and Heitman J. (2002) Bioessays. 24(10):894-903.

C8 Ceramide

C8 Ceramide__Protein kinase activator LDE225 (Diphosphate)

Product Name C8 Ceramide

Description
Protein kinase activator

Purity >98% (TLC)

CAS No. 74713-59-0

Molecular Formula C26H51NO3

Molecular Weight 425.7

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Activator

Solubility Soluble in DMSO (25 mg/ml) or 100% ethanol (25 mg/ml)

Source Synthetic

Appearance White waxy solid

SMILES CCCCCCCCCCCCC/C=C/email protected(email protected(CO)NC(=O)CCCCCCC)O

InChI InChI=1S/C26H51NO3/c1-3-5-7-9-10-11-12-13-14-15-16-18-19-21-25(29)24(23-28)27-26(30)22-20-17-8-6-4-2/h19,21,24-25,28-29H,3-18,20,22-23H2,1-2H3,(H,27,30)/b21-19+/t24-,25+/m0/s1

InChIKey APDLCSPGWPLYEQ-WRBRXSDHSA-N

Safety Phrases Classification:
Not a hazardous substance or mixture.

Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.

Cite This Product C8 Ceramide (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-499)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19117330

Alternative Names C8-Ceramide

Research Areas Cell Signaling

PubChem ID 5702614

Scientific Background C8 Ceramide is a biologically active ceramide analog. It is a protein kinase activator. It has also been shown to induce phosphorylation of EGF, as well as, apoptosis in vitro.

References 1. Józefowski S., et al. (2010) J. Immun. (Baltimore, Md.: 1950). 185(11): 6960–6973.
2. Gusain A., et al. (2012) Mol.Neurobio. 45(3): 455–464.

C2 Ceramide

C2 Ceramide__Cell permeable ceramide analog Paritaprevir

Product Name C2 Ceramide

Description
Cell permeable ceramide analog

Purity >98%

CAS No. 3102-57-6

Molecular Formula C20H39NO3

Molecular Weight 341.53

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inducer

Solubility Soluble to 100 mM in DMSO and to 100 mM in ethanol

Source Synthetic

Appearance White Solid

SMILES CCCCCCCCCCCCC/C=C/email protected(email protected(CO)NC(=O)C)O

InChI InChI=1S/C20H39NO3/c1-3-4-5-6-7-8-9-10-11-12-13-14-15-16-20(24)19(17-22)21-18(2)23/h15-16,19-20,22,24H,3-14,17H2,1-2H3,(H,21,23)/b16-15+

InChIKey BLTCBVOJNNKFKC-QUDYQQOWSA-N

Safety Phrases Classification: Caution: Substance not yet fully tested.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection

Cite This Product C2 Ceramide (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-232)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19117313

Alternative Names N-(2S,3R,4E)-1,3-Dihydroxy-4-octadecen-2-ylacetamide, N-Acetylsphingosine

Research Areas Cancer, Apoptosis

PubChem ID 5497136

Scientific Background Ceramides are a family of lipid molecules that are found in high concentrations within the cell membrane. They act as a signaling molecule. It is also a potent modulator of cell proliferation and differentiation.

References 1. Haimovitz A., et al. (1994) J Exp Med. 180(2): 525-535.

C16

C16__PKR kinase inhibitor GDC-0834

Product Name C16

Description
PKR kinase inhibitor

Purity >98% (HPLC)

CAS No. 608512-97-6

Molecular Formula C13H8N4OS

Molecular Weight 268.3

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble in DMSO 12 mg/ml

Source Synthetic

Appearance Solid

SMILES C1=CC2=C(C3=C1NC(=O)/C3=CC4=CNC=N4)SC=N2

InChI InChI=1S/C13H8N4OS/c18-13-8(3-7-4-14-5-15-7)11-9(17-13)1-2-10-12(11)19-6-16-10/h1-6H,(H,14,15)(H,17,18)/b8-3+

InChIKey VFBGXTUGODTSPK-FPYGCLRLSA-N

Safety Phrases Classification:
Chronic aquatic toxicity (Category 4), H413

Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.

Hazard statements:
H413 May cause long lasting harmful effects to aquatic life.

Precautionary statements:
P273 Avoid release to the environment.
P501 Dispose of contents/ container to an approved waste disposal plant.

Cite This Product C16 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-498)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19117058

Alternative Names Imidazolo-oxindole PKR inhibitor C16, 6,8-Dihydro-8-(1H-imidazol-5-ylmethylene)-7H-pyrrolo2,3-gbenzothiazol-7-one

Research Areas Cancer, Apoptosis, Cancer Growth Inhibitors, Cell Signaling, Tyrosine Kinase Inhibitors

PubChem ID 67016828

Scientific Background C16 is a derivative of imidazolo-oxindole and inhibits RNA-dependent protein kinases (PKR). Its inhibition effect on PKR is ATP-binding site directed. C16 has been shown to specifically inhibit the apoptotic PKR/eIF2a signaling pathway.

References 1. Couturier J., et al. (2010) J. Biol. Chem. 285(2): 1272–1282.
2. Jammi N.V., Whitby L.R., & Beal P.A. (2003) Biochem. Biophys.Res. Comm. 308(1):50–57.

Anti-c-Kit Antibody (Ser821+ Tyr823)

Anti-c-Kit Antibody (Ser821+ Tyr823)__Rabbit Anti-Human c-Kit (Ser821+ Tyr823) Polyclonal THZ1

Product Name c-Kit Antibody (Ser821+ Tyr823)

Description
Rabbit Anti-Human c-Kit (Ser821+ Tyr823) Polyclonal

Species Reactivity Human

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen A phospho-specific peptide corresponding to residues surrounding Ser821 and Tyr823 of human c-Kit (AA818-827)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 109.865 kDa.

Cite This Product Rabbit Anti-Human c-Kit (Ser821+ Tyr823) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1003)

Certificate of Analysis A 1:250 dilution of SPC-1003 was sufficient for detection of c-Kit (Ser821+ Tyr823) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19117056

Alternative Names C Kit Antibody, CD117 Antibody, Kit Antibody, KIT oncogene Antibody, Mast cell growth factor receptor Antibody, p145 c-kit Antibody, PBT Antibody, Proto oncogene tyrosine protein kinase Kit Antibody, SCF Receptor Antibody, soluble KIT variant 1 Antibody, Steel Factor Receptor Antibody, tyrosine protein kinase Kit Antibody, v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog Antibody

Cellular Localization Cell membrane

Accession Number NP_000213

Gene ID 3815

Swiss Prot P10721

Scientific Background c-KIT is a receptor tyrosine kinase that plays an essential role in the regulation of cell survival and proliferation, especially hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and melanogenesis. Following activation by KITLG/SCF binding, it can activate the PLCG1, AKT1, RAS, and STAT pathways. Activation of PLCG1 can lead to increased calcium signalling. Mutations leading to constitutive kinase activity have been associated with gastrointestinal stromal tumour, testicular tumours, and acute myelogenous leukemia. The human proto-oncogene c-kit was first identified as the homolog of the feline sarcoma viral oncogene v-kit.

Anti-c-Kit Antibody

Anti-c-Kit Antibody__Rabbit Anti-Human c-Kit Polyclonal GK921

Product Name c-Kit Antibody

Description
Rabbit Anti-Human c-Kit Polyclonal

Species Reactivity Human, Mouse

Applications ,
WB
,
AM

Antibody Dilution WB (1:250); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide of human c-KIT (AA119-133)

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.025% Thimerosal

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects 109.865 kDa.

Cite This Product Rabbit Anti-Human c-Kit Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1155)

Certificate of Analysis A 1:250 dilution of SPC-1155 was sufficient for detection of c-Kit in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/1911700

Alternative Names C Kit Antibody, CD117 Antibody, Kit Antibody, KIT oncogene Antibody, Mast cell growth factor receptor Antibody, p145 c-kit Antibody, PBT Antibody, Proto oncogene tyrosine protein kinase Kit Antibody, SCF Receptor Antibody, soluble KIT variant 1 Antibody, Steel Factor Receptor Antibody, tyrosine protein kinase Kit Antibody, v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog Antibody

Cellular Localization Cell membrane

Accession Number NP_000213

Gene ID 3815

Swiss Prot P10721

Scientific Background c-KIT is a receptor tyrosine kinase that plays an essential role in the regulation of cell survival and proliferation, especially hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and melanogenesis. Following activation by KITLG/SCF binding, it can activate the PLCG1, AKT1, RAS, and STAT pathways. Activation of PLCG1 can lead to increased calcium signalling. Mutations leading to constitutive kinase activity have been associated with gastrointestinal stromal tumour, testicular tumours, and acute myelogenous leukemia. The human proto-oncogene c-kit was first identified as the homolog of the feline sarcoma viral oncogene v-kit.

C-646

C-646__HAT inhibitor AZD3965

Product Name C-646

Description
HAT inhibitor

Purity >98% (TLC); NMR (Conforms)

CAS No. 328968-36-1

Molecular Formula C24H19N3O6

Molecular Weight 445.4

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble in 10 mg/ml DMSO

Source Synthetic

Appearance Orange Solid

SMILES CC1=CC(=C(C=C1C)N+(=O)O-)C2=CC=C(O2)/C=C/3C(=NN(C3=O)C4=CC=C(C=C4)C(=O)O)C

InChI InChI=1S/C24H19N3O6/c1-13-10-20(21(27(31)32)11-14(13)2)22-9-8-18(33-22)12-19-15(3)25-26(23(19)28)17-6-4-16(5-7-17)24(29)30/h4-12H,1-3H3,(H,29,30)/b19-12+

InChIKey HEKJYZZSCQBJGB-XDHOZWIPSA-N

Safety Phrases Classification: Caution – Substance not yet fully tested.
Safety Phrases:
S22 – Do not breathe dust
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
S24/25- Avoid contact with skin and eyes

Cite This Product C-646 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-350)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19116992

Alternative Names 4-4-5-(4,5-Dimethyl-2-nitrophenyl)-2-furanylmethylene-
4,5-dihydro-3-methyl-5-oxo-1Hpyrazol-
1-ylbenzoic acid

Research Areas Cell Signaling, Epigenetics

PubChem ID 1285940

Scientific Background Potent and selective inhibitor of the histone acetyl transferase p300/CBP (Ki=400 nM ). Induces apoptosis in prostate cancer cells. Enhances fear extinction memory and synaptic plasticity in mice. Promotes tau deacetylation reducing levels of pathogenic p-tau. Cell permeable.

References 1. Bowers E.M., et al. (2010) Chem. Biol. 17: 471.
2. Santer F.R., et al. (2011) Mol. Cancer Ther. 10: 1644.
3. Marek R., et al. (2011) J. Neurosci. 31: 7486.
4. Min S.W., et al. (2010) Neuron 67: 953.

BzATP

BzATP__Prototypic P2X7 receptor agonist NVP-BGJ398

Product Name BzATP

Description
Prototypic P2X7 receptor agonist

Purity 97.7%

CAS No. 112898-15-4

Molecular Formula C24H24N5O15P3•C18H45N3

Molecular Weight 1018.97

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Agonist

Solubility Soluble in water.

Source Synthetic

Appearance Off white solid

SMILES email protected3(OC@@H(C@@H(OC(=O)C1=CC=C(C=C1)C(=O)C2=CC=CC=C2)email protected3O)COP(OP(OP(=O)(O)O)(=O)O)(=O)O)N4C5=C(N=C4)C(=NC=N5)N

InChI InChI=1S/C24H24N5O15P3.C6H15N/c25-21-17-22(27-11-26-21)29(12-28-17)23-19(31)20(16(41-23)10-40-46(36,37)44-47(38,39)43-45(33,34)35)42-24(32)15-8-6-14(7-9-15)18(30)13-4-2-1-3-5-13;1-4-7(5-2)6-3/h1-9,11

InChIKey HVOVBTNCGADRTH-WBLDMZOZSA-N

Safety Phrases Classification: Not WHMIS controlled.
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.

Cite This Product BzATP (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-420)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19116923

Alternative Names 2'(3')-O-(4-Benzoylbenzoyl)adenosine-5'-triphosphate tri(triethylammonium) salt

Research Areas Ion Channels, Neuroscience

PubChem ID 71308559

Scientific Background BzATP triethylammonium salt is a prototypic P2X7 receptor agonist that exhibits 5 – 10 fold greater potency than ATP. This small molecule also exhibits partial agonist activity at P2X1 and P2Y1 receptors. Lastly, it can be used as a photoaffinity label for ATPase.

References 1. Young M., Pelegrin P., & Surprenant A. (2007) Mol Pharmacol. 92-100.

BVR Protein

BVR Protein__Rat Natural BVR Full Length Protein PF-04449913

Product Name BVR Protein

Description
Rat Natural BVR Full Length Protein

Applications ,
WB
,
SDS-PAGE

Concentration Lot/batch specific. See included datasheet.

Conjugates No tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Nature Natural

Species Rat

Expression System Native

Amino Acid Sequence MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK

Purity >90%

Protein Length Full Length

Storage Buffer 10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol

Storage Temperature -80ºC

Shipping Temperature Blue Ice or 4ºC

Purification Ion-exchange Purified

Specificity ~36 kDa

Cite This Product Rat Natural BVR Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-320)

Certificate of Analysis This product has been certified >90% pure using SDSPAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19116921

Alternative Names Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein

Research Areas Cancer, Oxidative Stress

Cellular Localization Cytoplasm

Accession Number NP_446302.1

Gene ID 116599

Swiss Prot P46844

Scientific Background Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

References 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789.
2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962.
3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.

Anti-BVR Antibody

Anti-BVR Antibody__Rabbit Anti-Human BVR Polyclonal Palbociclib

Product Name BVR Antibody

Description
Rabbit Anti-Human BVR Polyclonal

Species Reactivity Human

Applications ,
WB
,
IHC
,
ICC/IF
,
IP

Antibody Dilution WB (1:2000), ICC/IF (1:120), IP (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Human native full-length BVR

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein A purified

Clonality Polyclonal

Specificity Detects ~40-42kDa.

Cite This Product Rabbit Anti-Human BVR Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-214)

Certificate of Analysis 1 µg/ml of SPC-214 was sufficient for detection of BVR in 10 µg of mixed human cell line lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19116915

Alternative Names Biliverdin Reductase Antibody, BIEA_HUMAN Antibody, Biliverdin IX alpha reductase Antibody, Biliverdin reductase A Antibody, Biliverdin-IX alpha-reductase Antibody, BLVR A Antibody, BLVR Antibody, Blvra Antibody, BVR A Antibody, BVRA Antibody, Zinc metalloprotein Antibody, zinc-metalloprotein Antibody

Research Areas Cancer, Cell Signaling, Oxidative Stress

Cellular Localization Cytoplasm

Accession Number NP_000703.2

Gene ID 644

Swiss Prot P53004

Scientific Background Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

References 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789.
2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962.
3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.