Tankyrase-tankyrase.com

Anti-Amyloid Fibrils (OC) Antibody

Anti-Amyloid Fibrils (OC) Antibody__Rabbit Anti-Human Amyloid Fibrils (OC) Polyclonal Methylnaltrexone (Bromide)

Product Name Amyloid Fibrils (OC) Antibody

Description
Rabbit Anti-Human Amyloid Fibrils (OC) Polyclonal

Species Reactivity Human

Applications ,
WB
,
IHC
,
ICC/IF
,
IP
,
ELISA
,
DB

Antibody Dilution WB (1:1000), IHC (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Fibrils prepared from human A?42 peptide

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein A purified

Clonality Polyclonal

Specificity Recognizes generic epitopes common to many amyloid fibrils and fibrillar oligomers, but not prefibrilllar oligomers or natively folded proteins. Expected to detect in Mouse and Rat based on species h

Cite This Product Rabbit Anti-Human Amyloid Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-507)

Certificate of Analysis A 1:1000 dilution of SPC-507 was sufficient for detection of amyloid fibrils on PVDF membranes using transferred fibrils by colorimetric dot blot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19114171

Alternative Names OC Antibody, Fibrils Antibody, Amyloid Oligomer aß Antibody, A11 Antibody, Amyloid beta A4 protein Antibody, ABPP Antibody, APPI Antibody, Alzheimer disease amyloid protein Antibody, Cerebral vascular amyloid peptide Antibody, PreA4 Antibody, Protease nexin-II Antibody, APP Antibody, A4 Antibody, AD Antibody

Research Areas Blood, Cardiovascular System, Cell Signaling, Neuroscience

Cellular Localization Membrane

Scientific Background Amyloid monomeric proteins can sometimes oligomerize into destructive amyloid fibrils. Amyloidogenic conformations of non-disease related proteins can be created by partial protein misfolding or denaturation. Many degenerative diseases are known to be related to the accumulation of misfolded proteins as amyloid fibres (1, 2). These include the amyloid-β peptide plaques and tau neurofibrillary tangles in senile plaques of Alzheimer’s symptomology, the deposition of α-synuclein in the Lewy bodies of Parkinson’s disease, and accumulation of polyglutamine-containing aggregates in Huntington’s disease (2, 3).

References 1. Glabe C.G. (2004) Trends Biochem Sci. 29(10): 542-547.
2. Kayed R., et al. (2004) J Bio. Chem. 279: 46363-46366.
3. Kayed R., et al. (2003) Science. 300(5618): 486-489.

Amlodipine

Amlodipine__L-type Ca channel blocker LY2606368 (dihydrochloride)

Product Name Amlodipine

Description
L-type Ca channel blocker

Purity >98%

CAS No. 111470-99-6

Molecular Formula C20H25ClN2O5•C6H5SO3H

Molecular Weight 567.05

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble to 100 mM in DMSO and to 10 mM in water

Source Synthetic

Appearance White Solid

SMILES CCOC(=O)C1=C(NC(=C(C1C2=CC=CC=C2Cl)C(=O)OC)C)COCCN

InChI InChI=1S/C20H25ClN2O5/c1-4-28-20(25)18-15(11-27-10-9-22)23-12(2)16(19(24)26-3)17(18)13-7-5-6-8-14(13)21/h5-8,17,23H,4,9-11

InChIKey HTIQEAQVCYTUBX-UHFFFAOYSA-N

Safety Phrases Classification: Harmful. May be harmful if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
Risk Phrases:
R22 – Harmful if swallowed
R62 – Possible risk of impaired fertility
Hazard Phrases:
H302-H315-H319-H335
Precautionary Phrases:
P261-P305 + P351 + P338

Cite This Product Amlodipine (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-315)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19114084

Alternative Names 3-Ethyl 5-methyl 2-[(2-aminoethoxy)methyl]-4-(2-chlorophenyl)-6-methyl-1,4-dihydro-3,5-pyridinedicarboxylate, Norvasc

Research Areas Calcium Channels, Ion Channels, Neuroscience, Voltage-Gated Calcium Channels

PubChem ID 2162

Scientific Background Amlodipine is a long-acting calcium channel blocker used as an anti-hypertensive and in the treatment of angina. It acts by relaxing the smooth muscle in the arterial wall, decreasing total peripheral resistance and hence reducing blood pressure.

References 1. Luksa J., Josic D., Kremser M., Kopitar Z and Milutinovic S. (1997) J Chromatorgraphy. B, Biomed Sci and App. 693(2): 367-375.
2. Bahl V.K., Jadhav U.M., Thacker H.P. (2009) Am J Cardiovasc Drugs. 9(3): 135-142.

Amiodarone Hydrochloride

Amiodarone Hydrochloride__Autophagy inducer FRAX597

Product Name Amiodarone Hydrochloride

Description
Autophagy inducer

Purity >99%

CAS No. 19774-82-4

Molecular Formula C25H29I2NO3•HCl

Molecular Weight 681.77

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inducer

Solubility Soluble to 50 mM in DMSO

Source Synthetic

Appearance White solid

SMILES [H+].C1=CC=CC2=C1C(=C(O2)CCCC)C(=O)C3=CC(=C(OCCN(CC)CC)C(=C3)I)I.[Cl-]

InChI InChI=1S/C25H29I2NO3.ClH/c1-4-7-11-22-23(18-10-8-9-12-21(18)31-22)24(29)17-15-19(26)25(20(27)16-17)30-14-13-28(5-2)6-3;/h8-10,12,15-16H,4-7,11,13-14H2,1-3H3;1H

InChIKey ITPDYQOUSLNIHG-UHFFFAOYSA-N

Safety Phrases Classification: D1B- Toxic Material Causing Immediate and Serious, Toxic Effects, Toxic by inhalation.
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.
Hazard statements:
H303- May be harmful if swallowed.
H312 + H332- Harmful in contact with skin or if inhaled
Precautionary statements:
P280- Wear protective gloves/ protective clothing.

Cite This Product Amiodarone Hydrochloride (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-393)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19114037

Alternative Names 2-Butyl-3-benzofuranyl-4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl ketone hydrochloride

Research Areas Cancer, Autophagy

PubChem ID 441325

Scientific Background Amiodarone is a non-selective ion channel blocker. It has been found, when used in Saccharomyces cerevisiae, to induce an influx of Ca2+ followed by mitochondrial fragmentation and subsequent cell death. Amiodarone has also been shown to induce autophagy by inhibiting mTORC1. Lastly, Amiodarone has broad-spectrum fungicidal activity.

References 1. Zhang Y., et al. (2007). J Biol Chem. 282(52): 37844-53.
2. Balgi A., et al. (2009). PLoS One. 4(9): e7124.

Anti-AMIGO-1 Antibody [S86-36]

Anti-AMIGO-1 Antibody
[S86-36]__Mouse Anti-Human AMIGO-1 Monoclonal IgG1 Linsitinib

Product Name AMIGO-1 Antibody

Description
Mouse Anti-Human AMIGO-1 Monoclonal IgG1

Species Reactivity Human, Mouse, Rat

Applications ,
WB
,
IHC
,
ICC/IF

Antibody Dilution WB (1:1000); optimal dilutions for assays should be determined by the user.

Host Species Mouse

Immunogen Species Human

Immunogen Fusion protein amino acids 554-574 (cytoplasmic C-terminus) of human AMIGO-1

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS pH7.4, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Protein G Purified

Clonality Monoclonal

Clone Number S86-36

Isotype IgG1

Specificity Detects ~60-80kDa depending on maturity/glycosylation.

Cite This Product Mouse Anti-Human AMIGO1 Monoclonal, Clone S86-36 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SMC-438)

Certificate of Analysis 1 µg/ml of SMC-438 was sufficient for detection of AMIGO-1 in 20 µg of rat brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113931

Alternative Names AMIGO 1 Antibody, AMIGO1 Antibody, Adhesion molecule with Ig like domain 1 Antibody, Amphoterin-induced protein 1 Antibody, Alivin-2 Antibody, Alivin 2 Antibody, Ali2 Antibody, AMIGO Antibody, KIAA1163 Antibody, Amphoterin induced gene and ORF (Amigo) Antibody, Amphoterin induced protein 1 Antibody, MGC25558 Antibody, OTTHUMP00000013379 Antibody, RP23 89M15.6 Antibody

Research Areas Cell Structure, Neuroscience, Pre-Synaptic Markers

Cellular Localization Axon, Cell membrane, Cell projection

Accession Number NP_065754.2

Gene ID 57463

Swiss Prot Q86WK6

Scientific Background The amphoterin-induced gene and ORF (AMIGO) family of proteins consists of AMIGO1, AMIGO2 and AMIGO3. All three members are single pass type I membrane proteins that contain several leucine-rich repeats, one IgG domain and a transmembrane domain. The AMIGO proteins are specifically expressed on fiber tracts of neuronal tissues and participate in their formation. They can form complexes with each other, but can also self-bind. AMIGO1, also designated Alivin2, promotes growth and fasciculation of neurites and plays a role in myelination and fasciculation of developing neural axons. In cerebellar neurons, AMIGO2 (Alivin1) is crucial for depolarization-dependent survival. Similar to AMIGO1 and AMIGO2, AMIGO3 (Alivin3) plays a role in hemophilic and/or heterophilic cell-cell interaction and signal transduction.

References 1. Kuja-Panula J., Kiiltomäki M., Yamashiro T., Rouhiainen A. and Rauvala H. (2003) J. Cell Biol. 160: 963-973.
2. Clark H.F., et al. (2003) Genome Res. 13: 2265-2270.
3. On, T., Sekino-Suzuki N., Kikkawa Y., Yonekawa H. and Kawashima S. (2003) J. Neurosci. 23: 5887-5896.
4. Chen Y., Aulia S., Li L. and Tang B.L. (2006) Brain Res. Brain Res. Rev. 51: 265-274.

Amifostine

Amifostine__HIF-1α activator Baricitinib

Product Name Amifostine

Description
HIF-1α activator

Purity >98%

CAS No. 20537-88-6

Molecular Formula C5H15N2O3PS

Molecular Weight 214.22

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Activator

Solubility Soluble in water

Source Synthetic

Appearance White Solid

SMILES C(CN)CNCCSP(=O)(O)O

InChI InChI=1S/C5H15N2O3PS/c6-2-1-3-7-4-5-12-11(8,9)10/h7H,1-6H2,(H2,8,9,10)

InChIKey JKOQGQFVAUAYPM-UHFFFAOYSA-N

Safety Phrases Classification: Harmful. May be harmful if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S24/25 – Avoid contact with skin and eyes
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
Hazard Phrases:
H302

Cite This Product Amifostine (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-210)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113923

Alternative Names S-{2-[(3-Aminopropyl)amino]ethyl} dihydrogen phosphorothioate

Research Areas Cancer, Apoptosis

PubChem ID 2141

Scientific Background Amifostine is a cytoprotective adjuvant used in cancer chemotherapy and radiotherapy. Inside cells it detoxifies reactive metabolites of platinum and alkylating agents (1, 2). Other effects include accelerated DNA repair (1), induction of cellular hypoxia (1), inhibition of apoptosis (2), alteration of gene expression (2) and modification of enzyme activity (2).

References 1. Kouvaris J.R., Kouloulias V.E., Blahos L.J. (2007) Oncologist. 12(6): 738-747.
2. Amifostine: BC Cancer Agency. 2006-03-01.

Ambroxol HCl

Ambroxol HCl__Free radical scavenger Palovarotene

Product Name Ambroxol HCl

Description
Free radical scavenger

Purity >98%

CAS No. 23828-92-4

Molecular Formula C13H18Br2N2O•HCl

Molecular Weight 414.57

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Antioxidant

Solubility Soluble to 50 mM in DMSO

Source Synthetic

Appearance White Solid

SMILES C1CC(CCC1NCC2=C(C(=CC(=C2)Br)Br)N)O

InChI InChI=1S/C13H18Br2N2O/c14-9-5-8(13(16)12(15)6-9)7-17-10-1-3-11(18)4-2-10/h5-6,10-11,17-18H,1-4,7,16H2

InChIKey JBDGDEWWOUBZPM-UHFFFAOYSA-N

Safety Phrases Classification: Harmful. May be harmful if inhaled, swallowed or absorbed through skin.
Safety Phrases:
S22 – Do not breathe dust
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection
S45- In case of accident or if you feel unwell, seek medical advice immediately (show the label where possible)
Hazard Phrases:
H302

Cite This Product Ambroxol HCl (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-153)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/1911391

Alternative Names 4-[(2-Amino-3,5-dibromobenzyl)amino]cyclohexanol

Research Areas Cancer, Oxidative Stress

PubChem ID 2132

Scientific Background Ambroxol is a very potent inhibitor of the neuronal sodium channels (1). It is also a mucolytic agent with antioxidant, anti-viral and anti-inflammatory properties, and has been used effectively with respiratory diseases, and as throat logenzes (2).

References 1. Weiser T. (2006) Neurosci Lett. 395: 179-184.
2. Sanderson R.J., et al. (1976) Respir Phys. 27: 379-392.

Anti-AMBRA1 Antibody

Anti-AMBRA1 Antibody__Rabbit Anti-Human AMBRA1 Polyclonal THZ1 (Hydrochloride)

Product Name AMBRA1 Antibody

Description
Rabbit Anti-Human AMBRA1 Polyclonal

Species Reactivity Human, Rat

Applications ,
WB
,
ICC/IF

Antibody Dilution WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide from the C-terminal of Human AMBRA1 (aa. 202-212)

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects ~142 kDa.

Cite This Product Rabbit Anti-Human AMBRA1 Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-644)

Certificate of Analysis A 1:1000 dilution of SPC-644 was sufficient for detection of AMBRA1 in 15 µg of Rat Brain Lysates by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113890

Alternative Names AMBRA1 Antibody, Activating molecule in BECN1-regulated autophagy protein 1 Antibody, KIAA1736 Antibody

Cellular Localization Autophagosome, Cytoplasmic Vesicle

Accession Number NP_001254711.1

Gene ID 55626

Swiss Prot Q9C0C7

Alsterpaullone

Alsterpaullone__CDK, GSK Inhibitor Presatovir

Product Name Alsterpaullone

Description
CDK, GSK Inhibitor

Purity >98% (HPLC)

CAS No. 237430-03-4

Molecular Formula C16H11N3O3

Molecular Weight 293.3

Storage Temperature -20ºC

Shipping Temperature Shipped Ambient

Product Type Inhibitor

Solubility Soluble in DMSO; insoluble in water or 100% ethanol

Source Synthetic

Appearance Yellow to brown powder

SMILES C1C2=C(C3=CC=CC=C3NC1=O)NC4=C2C=C(C=C4)[N+](=O)[O-]

InChI InChI=1S/C16H11N3O3/c20-15-8-12-11-7-9(19(21)22)5-6-14(11)18-16(12)10-3-1-2-4-13(10)17-15/h1-7,18H,8H2,(H,17,20)

InChIKey OLUKILHGKRVDCT-UHFFFAOYSA-N

Safety Phrases Classification:
Skin irritation (Category 2), H315
Eye irritation (Category 2A), H319
Specific target organ toxicity – single exposure (Category 3), Respiratory system, H335

Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.

Hazard statements:
H315 Causes skin irritation.
H319 Causes serious eye irritation.
H335 May cause respiratory irritation.

Precautionary statements:
P261 Avoid breathing dust/ fume/ gas/ mist/ vapours/ spray.
P264 Wash skin thoroughly after handling.
P271 Use only outdoors or in a well – ventilated area.
P280 Wear protective gloves/ eye protection/ face protection.
P302 + P352 IF ON SKIN: Wash with plenty of soap and water.
P304 + P340 IF INHALED: Remove victim to fresh air and keep at rest in a position comfortable for breathing.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
P312 Call a POISON CENTER or doctor/ physician if you feel unwell.
P321 Specific treatment (see supplemental first aid instructions on this label).
P332 + P313 If skin irritation occurs: Get medical advice/ attention.
P337 + P313 If eye irritation persists: Get medical advice/ attention.
P362 Take off contaminated clothing and wash before reuse.
P403 + P233 Store in a well – ventilated place. Keep container tightly closed.
P405 Store locked up.
P501 Dispose of contents/ container to an approved waste disposal plant.

Cite This Product Alsterpaullone (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-431)

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113877

Alternative Names 9-Nitro-7,12-dihydroindolo-[3,2-d][1]benzazepin-6(5)-one

Research Areas Cancer, Apoptosis, Cancer Growth Inhibitors, Cell Signaling, Tyrosine Kinase Inhibitors

PubChem ID 5005498

Scientific Background Alsterpaullone is a potent inhibitor of CDK1/cyclin B. It is also a potent and selective inhibitor of GSK-3β and CDK5/p25. Alsterpaullone induces apoptosis by activating caspase-8 and caspase-9, followed by disruption of the mitochondrial potential. It is cell-permeable.

References 1. Zaharevitz D.W., et al. (1999). Cancer Research. 59(11): 2566–2569.
2. Lahusen T., De Siervi A., Kunick C., & Senderowicz A.M. (2003) Mol. Carcinogenesis. 36(4): 183–194.
3. Schultz C., et al. (1999) J. Med. Chem. 42(15): 2909–2919.

Anti-alpha Tubulin Antibody

Anti-alpha Tubulin Antibody__Rabbit Anti-Human alpha Tubulin Antibody Polyclonal PSI-7976

Product Name alpha Tubulin Antibody

Description
Rabbit Anti-Human alpha Tubulin Antibody Polyclonal

Species Reactivity Human

Applications ,
WB
,
ICC/IF

Antibody Dilution WB (1:1000); ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Host Species Rabbit

Immunogen Species Human

Immunogen Synthetic peptide of Human alpha-Tubulin

Concentration 1 mg/ml

Conjugates Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, Unconjugated

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Storage Buffer PBS, 50% glycerol, 0.09% sodium azide

Storage Temperature -20ºC

Shipping Temperature Blue Ice or 4ºC

Purification Peptide Affinity Purified

Clonality Polyclonal

Specificity Detects ~50 kDa.

Cite This Product Rabbit Anti-Human alpha Tubulin Antibody Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-692)

Certificate of Analysis A 1:1000 dilution of SPC-692 was sufficient for detection of alpha-Tubulin in 15 µg of Human HeLa Cell Lysates by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113871

Alternative Names Alpha-tubulin ubiquitous Antibody, Alpha tubulin ubiquitous Antibody, Tubulin alpha 1B chain Antibody, Tubulin alpha ubiquitous Antibody, Tubulin K-alpha-1 Antibody, TBA1B_HUMAN Antibody, K alpha 1 Antibody, Tubulin alpha ubiquitous chain Antibody, Tubulin alpha 1B Antibody, TUBA1B Antibody, Tubulin alpha-1B chain Antibody, Tubulin alpha-ubiquitous chain Antibody, Tubulin K alpha 1 Antibody

Cellular Localization Cytoplasm, Cytoskeleton

Accession Number NP_006073.2

Gene ID 10376

Swiss Prot P68363

Alpha Synuclein Protein

Alpha Synuclein Protein__Human Recombinant Alpha Synuclein Protein Aggregate (Control) Mc-Val-Cit-PABC-PNP

Product Name Alpha Synuclein Protein

Description
Human Recombinant Alpha Synuclein Protein Aggregate (Control)

Applications ,
WB
,
SDS-PAGE
,
In vivo assay
,
In vitro assay

Concentration Lot/batch specific. See included datasheet.

Conjugates No tag

APC (Allophycocyanin)

Overview:

High quantum yield

Large phycobiliprotein

6 chromophores per molecule

Isolated from red algae

Molecular Weight: 105 kDa

APC Datasheet
Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

ATTO 390

Overview:

High fluorescence yield

Large Stokes-shift (89 nm)

Good photostability

Moderately hydrophilic

Good solubility in polar solvents

Coumarin derivate, uncharged

Low molar mass: 343.42 g/mol

ATTO 390 Datasheet
Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

ATTO 488

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 804 g/mol

ATTO 488 Datasheet
Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 565

Overview:

High fluorescence yield

High thermal and photostability

Good solubility in polar solvents

Excellent solubility in water

Very little aggregation

Rhodamine dye derivative

Molar Mass: 611 g/mol

ATTO 565 Datasheet
Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 594

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

New dye with net charge of -1

Molar Mass: 1137 g/mol

ATTO 594 Datasheet
Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 633

Overview:

High fluorescence yield

High thermal and photostability

Moderately hydrophilic

Good solubility in polar solvents

Stable at pH 4 – 11

Cationic dye, perchlorate salt

Molar Mass: 652.2 g/mol

ATTO 633 Datasheet
Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 655

Overview:

High fluorescence yield

High thermal and photostability

Excellent ozone resistance

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 634 g/mol

ATTO 655 Datasheet
Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 680

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 631 g/mol

ATTO 680 Datasheet
Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 700

Overview:

High fluorescence yield

Excellent thermal and photostability

Quenched by electron donors

Very hydrophilic

Good solubility in polar solvents

Zwitterionic dye

Molar Mass: 575 g/mol

ATTO 700 Datasheet
Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield

High rate of photobleaching

Good solubility in water

Broad emission spectrum

pH dependent spectra

Molecular formula: C₂₀H₁₂O₅

Molar mass: 332.3 g/mol

FITC-Fluorescent-conjugate
Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield

High photostability

Very hydrophilic

Excellent solubility in water

Very little aggregation

PE/ATTO 594 Datasheet
Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex

Small phycobiliprotein

Isolated from red algae

Large stokes shift (195 nm)

Molecular Weight: 35 kDa

PerCP Datasheet
Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum

High quantum yield

Photostable

Member of the phycobiliprotein family

Isolated from red algae

Excellent solubility in water

Molecular Weight: 250 kDa

R-PE Datasheet
Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols

Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation

Catalyzes the conversion of:

Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products

Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products

Molecular weight: 140 kDa

Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target

Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors

Catalyzes the conversion of:

Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products

Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)

Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products

High turnover rate enables rapid generation of a strong signal

44 kDa glycoprotein

Extinction coefficient: 100 (403 nm)

Applications: Western blot, immunohistochemistry, and ELISA

HRP Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity

Molar mass: 244.31 g/mol

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Biotin Datasheet

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity

Molecular weight: 53 kDa

Formula: C₁₀H₁₆N₂O₃S

Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Nature Recombinant

Species Human

Expression System E. coli

Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Purity 92%

Protein Length Full Length

Storage Buffer 0.2µm filtered solution in 20mM tris, 150mM NaCl pH7.5

Storage Temperature -80ºC

Shipping Temperature Blue Ice or 4ºC

Purification Ion-exchange Purified

Specificity ~14.46 kDa

Cite This Product Human Recombinant Alpha Synuclein Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-317)

Certificate of Analysis Certified 92% pure using SDS-PAGE analysis.

References PubMed ID：:http://www.ncbi.nlm.nih.gov/pubmed/19113394

Alternative Names Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein

Research Areas Alzheimer_s Disease, Neurodegeneration, Neuroscience, Parkinson_s Disease

Cellular Localization Cytoplasm, Membrane, Nucleus

Accession Number NP_000336.1

Gene ID 6622

Swiss Prot P37840

Scientific Background Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4).
SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson’s disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).

References 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).
2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.
3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.
4. Kokhan V.S., Afanasyeva M.A., Van’kin G. (2012) Behav. Brain. Res. 231(1): 226-230.
5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.
6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.